General Information

  • ID:  hor002403
  • Uniprot ID:  O18845
  • Protein name:  Promotilin
  • Gene name:  MLN
  • Organism:  Ovis aries (Sheep)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYGEVQRMQEKERYKGQKKSLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ
  • Length:  90(26-115)
  • Propeptide:  MLSRKATAILLVVHAAAMLASQTEGFVPIFTYGEVQRMQEKERYKGQKKSLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ
  • Signal peptide:  MLSRKATAILLVVHAAAMLASQTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  W5PF20
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11859-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P11859-F1.pdbhor002403_AF2.pdbhor002403_ESM.pdb

Physical Information

Mass: 1197850 Formula: C453H745N133O140S3
Absent amino acids: CHW Common amino acids: E
pI: 9.89 Basic residues: 16
Polar residues: 19 Hydrophobic residues: 24
Hydrophobicity: -93.11 Boman Index: -24163
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 71.44
Instability Index: 5386.22 Extinction Coefficient cystines: 4470
Absorbance 280nm: 50.22

Literature

  • PubMed ID:  9427564
  • Title:  Isolation and Sequencing of the cDNA Encoding the Motilin Precursor From Sheep Intestine